PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 904120
Common NameARALYDRAFT_904120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 601aa    MW: 67157.3 Da    PI: 7.285
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
904120genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.3e-23124224198
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +   +++ l+v+v+r
  904120 124 FVKILTASDTSTHGGFSVLRKHATEClpsldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GQTGDLRVGVRR 224
             89****************************9666677789************************************************3..378888**9998 PP

2Auxin_resp97.91.4e-32250329183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t+++F v+Y+Pr   s+F+++v+k++ a+k+ +s+GmRf+m+fe+e+s+er ++Gt+vg  dl++ +Wp SkWrsL+
      904120 250 ASHAVTTTTIFVVFYKPRI--SQFIISVNKYMVAMKNGFSLGMRFRMRFEGEESPERIFTGTIVGSGDLSS-QWPASKWRSLQ 329
                 689***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.03E-38109253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-37118239IPR015300DNA-binding pseudobarrel domain
CDDcd100177.56E-20123224No hitNo description
SMARTSM010192.4E-21124226IPR003340B3 DNA binding domain
PfamPF023623.1E-21124224IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026124226IPR003340B3 DNA binding domain
PfamPF065071.2E-29250329IPR010525Auxin response factor
PfamPF023092.5E-15474576IPR033389AUX/IAA domain
SuperFamilySSF542772.75E-15484565No hitNo description
Gene3DG3DSA:3.10.20.2402.9E-4488563No hitNo description
PROSITE profilePS5174528.366489581IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MANVDADFRT SRSNDDQLYS ELWKACAGPL VEVPRSNERV FYFPQGHMEQ LVASTNQGVV  60
DQEIPVFNLP PKILCRVLSV MLKAEHETDE VYAQITLQPE EDQSEPTSLD PPLVEPAKPT  120
VDSFVKILTA SDTSTHGGFS VLRKHATECL PSLDMTQPTP TQELVARDLH GYEWRFKHIF  180
RGQPRRHLLT TGWSTFVTSK RLVAGDAFVF LRGQTGDLRV GVRRLAKQQS TMPASVISSQ  240
SMRLGVLATA SHAVTTTTIF VVFYKPRISQ FIISVNKYMV AMKNGFSLGM RFRMRFEGEE  300
SPERIFTGTI VGSGDLSSQW PASKWRSLQI QWDEPSSIPR PNKVSPWEIE PFSPSALTPT  360
PTQQQSKSKR SRPIEITGSP AASNFLSSFP QSHESNPSVK LLFHDIATER NSNKSVFSSG  420
LQCKKTEAPV TSCCRLFGFD LTSKPASAPI PCNKQLISVD SNISDSTPKC QDPNSSNSPK  480
EQKQQTSTRS RIKVQMQGTA VGRAVDLTLL RSYDELIKEL EKMFEIEGEL SPKDKWTIVF  540
TDDEGDMMLV GDDPWNEFCK MAKKLFIYPS DEVKKLSSKS LLPDEGTIVY LESDQRTVHV  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1661635317356Auxin response factor 1
4ldw_A1e-1661635317356Auxin response factor 1
4ldv_A1e-1661635317356Auxin response factor 1
4ldx_B1e-1661635317356Auxin response factor 1
4ldx_A1e-1661635317356Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299240.0AK229924.1 Arabidopsis thaliana mRNA for ARF1 family auxin responsive transcription factor like protein, complete cds, clone: RAFL22-28-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880250.10.0hypothetical protein ARALYDRAFT_904120
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLD7LEK50.0D7LEK5_ARALL; Auxin response factor
STRINGscaffold_403621.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11